SCOPe 2.08: Domain d1pwub2: 1pwu B:551-776

Lineage for d1pwub2 (1pwu B:551-776)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
   automatically mapped to Pfam PF07737

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries)

8. Domain d1pwub2: 1pwu B:551-776 [95248]
   Other proteins in same PDB: d1pwua3, d1pwub3
   complexed with small molecule inhibitor
   complexed with gm6, zn

Details for d1pwub2

PDB Entry: 1pwu, 2.7 Å

PDB Description: crystal structure of anthrax lethal factor complexed with (3-(n- hydroxycarboxamido)-2-isobutylpropanoyl-trp-methylamide), a known small molecule inhibitor of matrix metalloproteases.

PDB Compounds: (B:) Lethal Factor

SCOPe Domain Sequences for d1pwub2:

Sequence; same for both SEQRES and ATOM records:

>d1pwub2 d.92.1.14 (B:551-776) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihcfghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

Timeline for d1pwub2:

• d1pwub2 first appeared in SCOP 1.67
  
• d1pwub2 appears in SCOPe 2.07