| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins) automatically mapped to Pfam PF07737 |
| Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species) duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries) |
| Domain d1pwpa1: 1pwp A:30-263 [95232] Other proteins in same PDB: d1pwpa3, d1pwpb3 complexed with small molecule inhibitor complexed with nsc, zn |
PDB Entry: 1pwp (more details), 2.9 Å
SCOPe Domain Sequences for d1pwpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwpa1 d.92.1.14 (A:30-263) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ktqeehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdgdit
khislealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekalnvyy
eigkilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefleqn
snevqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr
Timeline for d1pwpa1: