Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (14 proteins) Common fold covers whole protein structure |
Protein Aldose reductase (aldehyde reductase) [51436] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [51437] (16 PDB entries) |
Domain d1pwma_: 1pwm A: [95231] complexed with cl, fid, nap |
PDB Entry: 1pwm (more details), 0.92 Å
SCOP Domain Sequences for d1pwma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwma_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens)} masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca llsctshkdypfheef
Timeline for d1pwma_: