Lineage for d1pwja_ (1pwj A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859008Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 859009Superfamily d.39.1: DLC [54648] (1 family) (S)
  5. 859010Family d.39.1.1: DLC [54649] (2 proteins)
    8 kDa dynein light chain, DLC8
  6. 859011Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 859023Species Rat (Rattus norvegicus) [TaxId:10116] [54652] (5 PDB entries)
  8. 859028Domain d1pwja_: 1pwj A: [95228]

Details for d1pwja_

PDB Entry: 1pwj (more details)

PDB Description: structure of the monomeric 8-kda dynein light chain and mechanism of domain swapped dimer assembly
PDB Compounds: (A:) dynein light chain-2

SCOP Domain Sequences for d1pwja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwja_ d.39.1.1 (A:) Dynein light chain 1 (DLC1) {Rat (Rattus norvegicus) [TaxId: 10116]}
msdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg

SCOP Domain Coordinates for d1pwja_:

Click to download the PDB-style file with coordinates for d1pwja_.
(The format of our PDB-style files is described here.)

Timeline for d1pwja_: