Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins) |
Protein L-serine dehydratase [102668] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [102669] (2 PDB entries) |
Domain d1pwhc_: 1pwh C: [95226] |
PDB Entry: 1pwh (more details), 2.6 Å
SCOP Domain Sequences for d1pwhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwhc_ c.79.1.1 (C:) L-serine dehydratase {Rat (Rattus norvegicus)} maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv ivcggsnislaqlqalkaqlglnellk
Timeline for d1pwhc_: