SCOP 1.67: Domain d1pwhc_: 1pwh C:

Lineage for d1pwhc_ (1pwh C:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)

6. Protein L-serine dehydratase [102668] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [102669] (2 PDB entries)

8. Domain d1pwhc_: 1pwh C: [95226]

Details for d1pwhc_

PDB Entry: 1pwh, 2.6 Å

PDB Description: rat liver l-serine dehydratase- complex with pyridoxyl-(o-methyl- serine)-5-monophosphate

SCOP Domain Sequences for d1pwhc_:

Sequence; same for both SEQRES and ATOM records:

>d1pwhc_ c.79.1.1 (C:) L-serine dehydratase {Rat (Rattus norvegicus)}
maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
ivcggsnislaqlqalkaqlglnellk

Timeline for d1pwhc_:

• d1pwhc_ is new in SCOP 1.67
  
• d1pwhc_ appears in SCOP 1.69
  
• d1pwhc_ appears in the current release, SCOPe 2.08