Lineage for d1pwhb_ (1pwh B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 402241Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 402242Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 402243Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)
  6. 402307Protein L-serine dehydratase [102668] (1 species)
  7. 402308Species Rat (Rattus norvegicus) [TaxId:10116] [102669] (2 PDB entries)
  8. 402310Domain d1pwhb_: 1pwh B: [95225]

Details for d1pwhb_

PDB Entry: 1pwh (more details), 2.6 Å

PDB Description: rat liver l-serine dehydratase- complex with pyridoxyl-(o-methyl- serine)-5-monophosphate

SCOP Domain Sequences for d1pwhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwhb_ c.79.1.1 (B:) L-serine dehydratase {Rat (Rattus norvegicus)}
maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
ivcggsnislaqlqalkaqlglnellk

SCOP Domain Coordinates for d1pwhb_:

Click to download the PDB-style file with coordinates for d1pwhb_.
(The format of our PDB-style files is described here.)

Timeline for d1pwhb_: