![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins) |
![]() | Protein L-serine dehydratase [102668] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [102669] (2 PDB entries) |
![]() | Domain d1pwee_: 1pwe E: [95222] |
PDB Entry: 1pwe (more details), 2.8 Å
SCOP Domain Sequences for d1pwee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwee_ c.79.1.1 (E:) L-serine dehydratase {Rat (Rattus norvegicus)} slhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhfvcssa gnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqlakalek nnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqglrevgw edvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehpifsev isdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvvivcgg snislaqlqalkaql
Timeline for d1pwee_: