Lineage for d1pwee_ (1pwe E:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 402241Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 402242Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 402243Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)
  6. 402307Protein L-serine dehydratase [102668] (1 species)
  7. 402308Species Rat (Rattus norvegicus) [TaxId:10116] [102669] (2 PDB entries)
  8. 402317Domain d1pwee_: 1pwe E: [95222]

Details for d1pwee_

PDB Entry: 1pwe (more details), 2.8 Å

PDB Description: Rat Liver L-Serine Dehydratase Apo Enzyme

SCOP Domain Sequences for d1pwee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwee_ c.79.1.1 (E:) L-serine dehydratase {Rat (Rattus norvegicus)}
slhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhfvcssa
gnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqlakalek
nnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqglrevgw
edvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehpifsev
isdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvvivcgg
snislaqlqalkaql

SCOP Domain Coordinates for d1pwee_:

Click to download the PDB-style file with coordinates for d1pwee_.
(The format of our PDB-style files is described here.)

Timeline for d1pwee_: