Lineage for d1pwed_ (1pwe D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387142Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1387143Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1387144Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1387233Protein L-serine dehydratase [102668] (2 species)
  7. 1387236Species Norway rat (Rattus norvegicus) [TaxId:10116] [102669] (2 PDB entries)
  8. 1387244Domain d1pwed_: 1pwe D: [95221]

Details for d1pwed_

PDB Entry: 1pwe (more details), 2.8 Å

PDB Description: Rat Liver L-Serine Dehydratase Apo Enzyme
PDB Compounds: (D:) L-serine dehydratase

SCOPe Domain Sequences for d1pwed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwed_ c.79.1.1 (D:) L-serine dehydratase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
slhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhfvcssa
gnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqlakalek
nnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqglrevgw
edvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehpifsev
isdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvvivcgg
snislaqlqalkaql

SCOPe Domain Coordinates for d1pwed_:

Click to download the PDB-style file with coordinates for d1pwed_.
(The format of our PDB-style files is described here.)

Timeline for d1pwed_: