SCOP 1.67: Domain d1pwed_: 1pwe D:

Lineage for d1pwed_ (1pwe D:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)

6. Protein L-serine dehydratase [102668] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [102669] (2 PDB entries)

8. Domain d1pwed_: 1pwe D: [95221]

Details for d1pwed_

PDB Entry: 1pwe, 2.8 Å

PDB Description: Rat Liver L-Serine Dehydratase Apo Enzyme

SCOP Domain Sequences for d1pwed_:

Sequence; same for both SEQRES and ATOM records:

>d1pwed_ c.79.1.1 (D:) L-serine dehydratase {Rat (Rattus norvegicus)}
slhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhfvcssa
gnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqlakalek
nnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqglrevgw
edvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehpifsev
isdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvvivcgg
snislaqlqalkaql

Timeline for d1pwed_:

• d1pwed_ is new in SCOP 1.67
  
• d1pwed_ appears in SCOP 1.69
  
• d1pwed_ appears in the current release, SCOPe 2.08