Lineage for d1pwbc1 (1pwb C:235-355)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421327Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 421328Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 421329Family d.169.1.1: C-type lectin domain [56437] (22 proteins)
  6. 421599Protein Surfactant protein, lectin domain [56461] (2 species)
  7. 421600Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (3 PDB entries)
  8. 421603Domain d1pwbc1: 1pwb C:235-355 [95216]
    Other proteins in same PDB: d1pwba2, d1pwbb2, d1pwbc2
    complexed with ca, glc

Details for d1pwbc1

PDB Entry: 1pwb (more details), 1.4 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d with maltose

SCOP Domain Sequences for d1pwbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwbc1 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOP Domain Coordinates for d1pwbc1:

Click to download the PDB-style file with coordinates for d1pwbc1.
(The format of our PDB-style files is described here.)

Timeline for d1pwbc1: