SCOP 1.73: Domain d1pwbb2: 1pwb B:205-234

Lineage for d1pwbb2 (1pwb B:205-234)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (2 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (9 PDB entries)

8. Domain d1pwbb2: 1pwb B:205-234 [95215]
   Other proteins in same PDB: d1pwba1, d1pwbb1, d1pwbc1

Details for d1pwbb2

PDB Entry: 1pwb, 1.4 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d with maltose

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOP Domain Sequences for d1pwbb2:

Sequence; same for both SEQRES and ATOM records:

>d1pwbb2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

Timeline for d1pwbb2:

• d1pwbb2 first appeared in SCOP 1.67
  
• d1pwbb2 appears in SCOP 1.71
  
• d1pwbb2 appears in SCOP 1.75
  
• d1pwbb2 appears in the current release, SCOPe 2.08