| Class h: Coiled coil proteins [57942] (6 folds) |
| Fold h.1: Parallel coiled-coil [57943] (27 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
| Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
| Protein Surfactant protein [57949] (2 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (4 PDB entries) |
| Domain d1pwba2: 1pwb A:205-234 [95213] Other proteins in same PDB: d1pwba1, d1pwbb1, d1pwbc1 |
PDB Entry: 1pwb (more details), 1.4 Å
SCOP Domain Sequences for d1pwba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwba2 h.1.1.1 (A:205-234) Surfactant protein {Human (Homo sapiens), SP-D}
aslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d1pwba2:
View in 3DDomains from other chains: (mouse over for more information) d1pwbb1, d1pwbb2, d1pwbc1, d1pwbc2 |