![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (24 proteins) Pfam 00059 |
![]() | Protein Surfactant protein, lectin domain [56461] (2 species) |
![]() | Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (3 PDB entries) |
![]() | Domain d1pwba1: 1pwb A:235-355 [95212] Other proteins in same PDB: d1pwba2, d1pwbb2, d1pwbc2 |
PDB Entry: 1pwb (more details), 1.4 Å
SCOP Domain Sequences for d1pwba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d1pwba1:
![]() Domains from other chains: (mouse over for more information) d1pwbb1, d1pwbb2, d1pwbc1, d1pwbc2 |