Lineage for d1pwaa_ (1pwa A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791607Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2791898Protein Fibroblast growth factor-19 (FGF19) [101778] (1 species)
  7. 2791899Species Human (Homo sapiens) [TaxId:9606] [101779] (1 PDB entry)
  8. 2791900Domain d1pwaa_: 1pwa A: [95211]
    complexed with gol, so4, trs

Details for d1pwaa_

PDB Entry: 1pwa (more details), 1.3 Å

PDB Description: Crystal structure of Fibroblast Growth Factor 19
PDB Compounds: (A:) Fibroblast growth factor-19

SCOPe Domain Sequences for d1pwaa_:

Sequence, based on SEQRES records: (download)

>d1pwaa_ b.42.1.1 (A:) Fibroblast growth factor-19 (FGF19) {Human (Homo sapiens) [TaxId: 9606]}
pirlrhlytsgphglsscflriradgvvdcargqsahslleikavalrtvaikgvhsvry
lcmgadgkmqgllqyseedcafeeeirpdgynvyrsekhrlpvslssakqrqlyknrgfl
plshflpmlpmvpeep

Sequence, based on observed residues (ATOM records): (download)

>d1pwaa_ b.42.1.1 (A:) Fibroblast growth factor-19 (FGF19) {Human (Homo sapiens) [TaxId: 9606]}
pirlrhlytsgphglsscflriradgvvdcargqsahslleikavalrtvaikgvhsvry
lcmgadgkmqgllqyseedcafeeeirpdgynvyrsekhrlpvslslplshflpmlpmvp
eep

SCOPe Domain Coordinates for d1pwaa_:

Click to download the PDB-style file with coordinates for d1pwaa_.
(The format of our PDB-style files is described here.)

Timeline for d1pwaa_: