Lineage for d1pw9a2 (1pw9 A:205-234)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752209Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 752210Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 752282Protein Surfactant protein [57949] (2 species)
  7. 752283Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (9 PDB entries)
  8. 752290Domain d1pw9a2: 1pw9 A:205-234 [95206]
    Other proteins in same PDB: d1pw9a1, d1pw9b1, d1pw9c1

Details for d1pw9a2

PDB Entry: 1pw9 (more details), 1.6 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOP Domain Sequences for d1pw9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pw9a2 h.1.1.1 (A:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOP Domain Coordinates for d1pw9a2:

Click to download the PDB-style file with coordinates for d1pw9a2.
(The format of our PDB-style files is described here.)

Timeline for d1pw9a2: