Lineage for d1pw9a1 (1pw9 A:235-355)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738241Protein Surfactant protein, lectin domain [56461] (2 species)
  7. 738242Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (8 PDB entries)
  8. 738249Domain d1pw9a1: 1pw9 A:235-355 [95205]
    Other proteins in same PDB: d1pw9a2, d1pw9b2, d1pw9c2

Details for d1pw9a1

PDB Entry: 1pw9 (more details), 1.6 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOP Domain Sequences for d1pw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pw9a1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOP Domain Coordinates for d1pw9a1:

Click to download the PDB-style file with coordinates for d1pw9a1.
(The format of our PDB-style files is described here.)

Timeline for d1pw9a1: