Lineage for d1pw7c_ (1pw7 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 996948Protein Purine nucleoside phosphorylase, PNP [53169] (10 species)
  7. 996999Species Escherichia coli [TaxId:562] [53172] (19 PDB entries)
  8. 997014Domain d1pw7c_: 1pw7 C: [95204]
    complexed with po4, rab

Details for d1pw7c_

PDB Entry: 1pw7 (more details), 2 Å

PDB Description: crystal structure of e. coli purine nucleoside phosphorylase complexed with 9-beta-d-arabinofuranosyladenine and sulfate/phosphate
PDB Compounds: (C:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1pw7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pw7c_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 562]}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

SCOPe Domain Coordinates for d1pw7c_:

Click to download the PDB-style file with coordinates for d1pw7c_.
(The format of our PDB-style files is described here.)

Timeline for d1pw7c_: