Lineage for d1pvyb_ (1pvy B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578543Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2578544Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2578559Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
    contains one additional helix in the C-terminal extension
    automatically mapped to Pfam PF00926
  6. 2578560Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)
  7. 2578573Species Methanocaldococcus jannaschii [TaxId:2190] [103219] (3 PDB entries)
    Uniprot Q60364
  8. 2578577Domain d1pvyb_: 1pvy B: [95196]
    complexed with 5rp, ca, zn

Details for d1pvyb_

PDB Entry: 1pvy (more details), 1.7 Å

PDB Description: 3,4-dihydroxy-2-butanone 4-phosphate synthase from m. jannaschii in complex with ribulose 5-phosphate
PDB Compounds: (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d1pvyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvyb_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Methanocaldococcus jannaschii [TaxId: 2190]}
nvekaiealkkgeiilvydsderegetdmvvasqfitpehirimrkdagglictalhpdi
cnklgipfmvdilefasqkfkvlrelypndipydekssfsitinhrktftgitdndraft
ikklaelvkegrfndfgkefrspgsvtllraaeglvknrqghtemtvalaelanlvpitt
icemmgddgnamsknetkryaekhnliylsgeeiinyyl

SCOPe Domain Coordinates for d1pvyb_:

Click to download the PDB-style file with coordinates for d1pvyb_.
(The format of our PDB-style files is described here.)

Timeline for d1pvyb_: