SCOPe 2.08: Domain d1pvyb_: 1pvy B:

Lineage for d1pvyb_ (1pvy B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (3 families)

5. Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
   contains one additional helix in the C-terminal extension
   automatically mapped to Pfam PF00926

6. Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [103219] (3 PDB entries)
   Uniprot Q60364

8. Domain d1pvyb_: 1pvy B: [95196]
   complexed with 5rp, ca, zn

Details for d1pvyb_

PDB Entry: 1pvy, 1.7 Å

PDB Description: 3,4-dihydroxy-2-butanone 4-phosphate synthase from m. jannaschii in complex with ribulose 5-phosphate

PDB Compounds: (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d1pvyb_:

Sequence; same for both SEQRES and ATOM records:

>d1pvyb_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Methanocaldococcus jannaschii [TaxId: 2190]}
nvekaiealkkgeiilvydsderegetdmvvasqfitpehirimrkdagglictalhpdi
cnklgipfmvdilefasqkfkvlrelypndipydekssfsitinhrktftgitdndraft
ikklaelvkegrfndfgkefrspgsvtllraaeglvknrqghtemtvalaelanlvpitt
icemmgddgnamsknetkryaekhnliylsgeeiinyyl

Timeline for d1pvyb_:

• d1pvyb_ first appeared in SCOP 1.67
  
• d1pvyb_ appears in SCOPe 2.07