![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.115: YrdC/RibB [55820] (1 superfamily) core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other |
![]() | Superfamily d.115.1: YrdC/RibB [55821] (3 families) ![]() |
![]() | Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins) contains one additional helix in the C-terminal extension automatically mapped to Pfam PF00926 |
![]() | Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species) |
![]() | Species Methanocaldococcus jannaschii [TaxId:2190] [103219] (3 PDB entries) Uniprot Q60364 |
![]() | Domain d1pvwa_: 1pvw A: [95192] complexed with ca, po4, zn |
PDB Entry: 1pvw (more details), 2.45 Å
SCOPe Domain Sequences for d1pvwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvwa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Methanocaldococcus jannaschii [TaxId: 2190]} nnvekaiealkkgeiilvydsderegetdmvvasqfitpehirimrkdagglictalhpd icnklgipfmvdilefasqkfkvlrelypndipydekssfsitinhrktftgitdndraf tikklaelvkegrfndfgkefrspghvtllraaeglvknrqghtemtvalaelanlvpit ticemmgddgnamsknetkryaekhnliylsgeeiinyy
Timeline for d1pvwa_: