Lineage for d1pvva1 (1pvv A:1-150)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) Protein Ornithine transcarbamoylase [53676] (5 species) 
Species Archaeon Pyrococcus furiosus [TaxId:2261] [53679] (2 PDB entries) 
Domain d1pvva1: 1pvv A:1-150 [95190]
Details for d1pvva1
PDB Entry: 1pvv (more details), 1.87 Å
PDB Description: Refined Structure of Pyrococcus furiosus Ornithine Carbamoyltransferase at 1.87 A
SCOP Domain Sequences for d1pvva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvva1 c.78.1.1 (A:1-150) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus}
vvslagrdllclqdytaeeiwtiletakmfkiwqkigkphrllegktlamifqkpstrtr
vsfevamahlgghalylnaqdlqlrrgetiadtarvlsryvdaimarvydhkdvedlaky
atvpvinglsdfshpcqaladymtiwekkg
SCOP Domain Coordinates for d1pvva1:
Click to download the PDB-style file with coordinates for d1pvva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pvva1:
- d1pvva1 is new in SCOP 1.67
- d1pvva1 appears in SCOP 1.69
- d1pvva1 appears in the current release, SCOPe 2.08
View in 3D
