Lineage for d1pvta_ (1pvt A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2155368Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2155369Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2155370Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
    metal (zinc)-ion dependent
  6. 2155442Protein Putative sugar-phosphate aldolase [102654] (1 species)
  7. 2155443Species Thermotoga maritima [TaxId:2336] [102655] (1 PDB entry)
  8. 2155444Domain d1pvta_: 1pvt A: [95189]
    structural genomics

Details for d1pvta_

PDB Entry: 1pvt (more details), 2.5 Å

PDB Description: Crystal structure of sugar-phosphate aldolase from Thermotoga maritima
PDB Compounds: (A:) sugar-phosphate aldolase

SCOPe Domain Sequences for d1pvta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvta_ c.74.1.1 (A:) Putative sugar-phosphate aldolase {Thermotoga maritima [TaxId: 2336]}
ghmretireiqkvaywlaikglseanagnisvrlderpegyevksvneygfdydgpemyl
litatgsrmrevyeddskicllhvlpgkhyeilhgngkptsefpthlmihakfkemnpek
kaivhthplnlltlmnleefqellpkmmkihpevliffpqgisvvefekpgsvelglktv
eksegkdavlwdkhgvvafgkdvaeaydrveilekaaeillrvlslgrnptg

SCOPe Domain Coordinates for d1pvta_:

Click to download the PDB-style file with coordinates for d1pvta_.
(The format of our PDB-style files is described here.)

Timeline for d1pvta_: