SCOP 1.71: Domain d1pvra1: 1pvr A:18-129

Lineage for d1pvra1 (1pvr A:18-129)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.60: SAM domain-like [47768] (14 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Cre recombinase [47825] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [47826] (18 PDB entries)

8. Domain d1pvra1: 1pvr A:18-129 [95185]
   Other proteins in same PDB: d1pvra2, d1pvrb2

Details for d1pvra1

PDB Entry: 1pvr, 2.65 Å

PDB Description: basis for a switch in substrate specificity: crystal structure of selected variant of cre site-specific recombinase, lnsgg bound to the loxp (wildtype) recognition site

SCOP Domain Sequences for d1pvra1:

Sequence; same for both SEQRES and ATOM records:

>d1pvra1 a.60.9.1 (A:18-129) Cre recombinase {Bacteriophage P1}
atsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdylly
lqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

Timeline for d1pvra1:

• d1pvra1 first appeared in SCOP 1.67
  
• d1pvra1 appears in SCOP 1.69
  
• d1pvra1 appears in SCOP 1.73
  
• d1pvra1 appears in the current release, SCOPe 2.08