Lineage for d1pvra1 (1pvr A:18-129)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539637Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 539638Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 539639Protein Cre recombinase [47825] (1 species)
  7. 539640Species Bacteriophage P1 [TaxId:10678] [47826] (18 PDB entries)
  8. 539671Domain d1pvra1: 1pvr A:18-129 [95185]
    Other proteins in same PDB: d1pvra2, d1pvrb2

Details for d1pvra1

PDB Entry: 1pvr (more details), 2.65 Å

PDB Description: basis for a switch in substrate specificity: crystal structure of selected variant of cre site-specific recombinase, lnsgg bound to the loxp (wildtype) recognition site

SCOP Domain Sequences for d1pvra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvra1 a.60.9.1 (A:18-129) Cre recombinase {Bacteriophage P1}
atsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdylly
lqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d1pvra1:

Click to download the PDB-style file with coordinates for d1pvra1.
(The format of our PDB-style files is described here.)

Timeline for d1pvra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pvra2