SCOP 1.69: Domain d1pvqb2: 1pvq B:130-341

Lineage for d1pvqb2 (1pvq B:130-341)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (16 PDB entries)

8. Domain d1pvqb2: 1pvq B:130-341 [95184]
   Other proteins in same PDB: d1pvqa1, d1pvqb1

Details for d1pvqb2

PDB Entry: 1pvq, 2.75 Å

PDB Description: basis for a switch in substrate specificity: crystal structure of selected variant of cre site-specific recombinase, lnsgg bound to the engineered recognition site loxm7

SCOP Domain Sequences for d1pvqb2:

Sequence, based on SEQRES records:

>d1pvqb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllrlaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlsnsalggifgathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Sequence, based on observed residues (ATOM records):

>d1pvqb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllrlaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlsnsalggifgathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirntgamvrlled

Timeline for d1pvqb2:

• d1pvqb2 first appeared in SCOP 1.67
  
• d1pvqb2 appears in SCOP 1.71
  
• d1pvqb2 appears in the current release, SCOPe 2.08