Lineage for d1pvqa2 (1pvq A:130-341)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420830Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 420831Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 420832Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 420833Protein Cre recombinase [56355] (1 species)
  7. 420834Species Bacteriophage P1 [TaxId:10678] [56356] (16 PDB entries)
  8. 420867Domain d1pvqa2: 1pvq A:130-341 [95182]
    Other proteins in same PDB: d1pvqa1, d1pvqb1

Details for d1pvqa2

PDB Entry: 1pvq (more details), 2.75 Å

PDB Description: basis for a switch in substrate specificity: crystal structure of selected variant of cre site-specific recombinase, lnsgg bound to the engineered recognition site loxm7

SCOP Domain Sequences for d1pvqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvqa2 d.163.1.1 (A:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllrlaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlsnsalggifgathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

SCOP Domain Coordinates for d1pvqa2:

Click to download the PDB-style file with coordinates for d1pvqa2.
(The format of our PDB-style files is described here.)

Timeline for d1pvqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pvqa1