SCOPe 2.05: Domain d1pvpb2: 1pvp B:130-341

Lineage for d1pvpb2 (1pvp B:130-341)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d1pvpb2: 1pvp B:130-341 [95180]
   Other proteins in same PDB: d1pvpa1, d1pvpb1
   protein/DNA complex

Details for d1pvpb2

PDB Entry: 1pvp, 2.35 Å

PDB Description: basis for a switch in substrate specificity: crystal structure of selected variant of cre site-specific recombinase, alshg bound to the engineered recognition site loxm7

PDB Compounds: (B:) Recombinase cre

SCOPe Domain Sequences for d1pvpb2:

Sequence, based on SEQRES records:

>d1pvpb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllraaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlslsalhgifgathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Sequence, based on observed residues (ATOM records):

>d1pvpb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllraaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlslsalhgifgathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirtgamvrlled

Timeline for d1pvpb2:

• d1pvpb2 first appeared in SCOP 1.67
  
• d1pvpb2 appears in SCOPe 2.04
  
• d1pvpb2 appears in SCOPe 2.06
  
• d1pvpb2 appears in the current release, SCOPe 2.08