Lineage for d1pvpb1 (1pvp B:19-129)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444553Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 444554Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 444555Protein Cre recombinase [47825] (1 species)
  7. 444556Species Bacteriophage P1 [TaxId:10678] [47826] (16 PDB entries)
  8. 444567Domain d1pvpb1: 1pvp B:19-129 [95179]
    Other proteins in same PDB: d1pvpa2, d1pvpb2

Details for d1pvpb1

PDB Entry: 1pvp (more details), 2.35 Å

PDB Description: basis for a switch in substrate specificity: crystal structure of selected variant of cre site-specific recombinase, alshg bound to the engineered recognition site loxm7

SCOP Domain Sequences for d1pvpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvpb1 a.60.9.1 (B:19-129) Cre recombinase {Bacteriophage P1}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d1pvpb1:

Click to download the PDB-style file with coordinates for d1pvpb1.
(The format of our PDB-style files is described here.)

Timeline for d1pvpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pvpb2