| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.60: SAM domain-like [47768] (14 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) ![]() |
| Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins) |
| Protein Cre recombinase [47825] (1 species) |
| Species Bacteriophage P1 [TaxId:10678] [47826] (18 PDB entries) |
| Domain d1pvpa1: 1pvp A:19-129 [95177] Other proteins in same PDB: d1pvpa2, d1pvpb2 |
PDB Entry: 1pvp (more details), 2.35 Å
SCOP Domain Sequences for d1pvpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvpa1 a.60.9.1 (A:19-129) Cre recombinase {Bacteriophage P1}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage
Timeline for d1pvpa1: