SCOP 1.73: Domain d1pvmb2: 1pvm B:65-142

Lineage for d1pvmb2 (1pvm B:65-142)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (10 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain

6. Protein Hypothetical protein Ta0289 [102899] (1 species)
   contains extra C-terminal zinc-finger domain

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102900] (1 PDB entry)

8. Domain d1pvmb2: 1pvm B:65-142 [95175]
   Other proteins in same PDB: d1pvma3, d1pvmb3
   structural genomics
   complexed with hg

Details for d1pvmb2

PDB Entry: 1pvm, 1.5 Å

PDB Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum

PDB Compounds: (B:) conserved hypothetical protein Ta0289

SCOP Domain Sequences for d1pvmb2:

Sequence; same for both SEQRES and ATOM records:

>d1pvmb2 d.37.1.1 (B:65-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
kpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltdlsry
lsrasitdillshrtkdy

Timeline for d1pvmb2:

• d1pvmb2 first appeared in SCOP 1.67
  
• d1pvmb2 appears in SCOP 1.71
  
• d1pvmb2 does not appear in SCOP 1.75