SCOP 1.69: Domain d1pvmb1: 1pvm B:-5-64

Lineage for d1pvmb1 (1pvm B:-5-64)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (4 proteins)
   pairs of CBS domains dimerize to form a stable globular domain

6. Protein Hypothetical protein Ta0289 [102899] (1 species)
   contains extra C-terminal zinc-finger domain

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102900] (1 PDB entry)

8. Domain d1pvmb1: 1pvm B:-5-64 [95174]
   Other proteins in same PDB: d1pvma3, d1pvmb3

Details for d1pvmb1

PDB Entry: 1pvm, 1.5 Å

PDB Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum

SCOP Domain Sequences for d1pvmb1:

Sequence; same for both SEQRES and ATOM records:

>d1pvmb1 d.37.1.1 (B:-5-64) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum}
vprgghmfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsers
iikrfiprnk

Timeline for d1pvmb1:

• d1pvmb1 first appeared in SCOP 1.67
  
• d1pvmb1 appears in SCOP 1.71
  
• d1pvmb1 last appears in SCOP 1.73