Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.37: CBS-domain [54630] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.37.1: CBS-domain [54631] (1 family) |
Family d.37.1.1: CBS-domain [54632] (4 proteins) pairs of CBS domains dimerize to form a stable globular domain |
Protein Hypothetical protein Ta0289 [102899] (1 species) contains extra C-terminal zinc-finger domain |
Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102900] (1 PDB entry) |
Domain d1pvmb1: 1pvm B:-5-64 [95174] Other proteins in same PDB: d1pvma3, d1pvmb3 |
PDB Entry: 1pvm (more details), 1.5 Å
SCOP Domain Sequences for d1pvmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvmb1 d.37.1.1 (B:-5-64) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum} vprgghmfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsers iikrfiprnk
Timeline for d1pvmb1: