![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.13: Hypothetical protein Ta0289 C-terminal domain [103623] (1 family) ![]() contains CxxC-x(n)-CxxxxC zinc-binding site; sequence similarity to NAD-dependent DNA ligase zinc-finger subdomain |
![]() | Family g.41.13.1: Hypothetical protein Ta0289 C-terminal domain [103624] (1 protein) |
![]() | Protein Hypothetical protein Ta0289 C-terminal domain [103625] (1 species) |
![]() | Species Archaeon Thermoplasma acidophilum [TaxId:2303] [103626] (1 PDB entry) |
![]() | Domain d1pvma3: 1pvm A:143-178 [95173] Other proteins in same PDB: d1pvma1, d1pvma2, d1pvmb1, d1pvmb2 |
PDB Entry: 1pvm (more details), 1.5 Å
SCOP Domain Sequences for d1pvma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvma3 g.41.13.1 (A:143-178) Hypothetical protein Ta0289 C-terminal domain {Archaeon Thermoplasma acidophilum} qhlcpkcgvgvlepvynekgeikvfrcsnpacdyee
Timeline for d1pvma3: