Lineage for d1pvma3 (1pvm A:143-178)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524521Superfamily g.41.13: Hypothetical protein Ta0289 C-terminal domain [103623] (1 family) (S)
    contains CxxC-x(n)-CxxxxC zinc-binding site; sequence similarity to NAD-dependent DNA ligase zinc-finger subdomain
  5. 524522Family g.41.13.1: Hypothetical protein Ta0289 C-terminal domain [103624] (1 protein)
  6. 524523Protein Hypothetical protein Ta0289 C-terminal domain [103625] (1 species)
  7. 524524Species Archaeon Thermoplasma acidophilum [TaxId:2303] [103626] (1 PDB entry)
  8. 524525Domain d1pvma3: 1pvm A:143-178 [95173]
    Other proteins in same PDB: d1pvma1, d1pvma2, d1pvmb1, d1pvmb2

Details for d1pvma3

PDB Entry: 1pvm (more details), 1.5 Å

PDB Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum

SCOP Domain Sequences for d1pvma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvma3 g.41.13.1 (A:143-178) Hypothetical protein Ta0289 C-terminal domain {Archaeon Thermoplasma acidophilum}
qhlcpkcgvgvlepvynekgeikvfrcsnpacdyee

SCOP Domain Coordinates for d1pvma3:

Click to download the PDB-style file with coordinates for d1pvma3.
(The format of our PDB-style files is described here.)

Timeline for d1pvma3: