Lineage for d1pvma1 (1pvm A:1-64)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502537Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 502538Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 502539Family d.37.1.1: CBS-domain [54632] (4 proteins)
    pairs of CBS domains dimerize to form a stable globular domain
  6. 502544Protein Hypothetical protein Ta0289 [102899] (1 species)
    contains extra C-terminal zinc-finger domain
  7. 502545Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102900] (1 PDB entry)
  8. 502546Domain d1pvma1: 1pvm A:1-64 [95171]
    Other proteins in same PDB: d1pvma3, d1pvmb3

Details for d1pvma1

PDB Entry: 1pvm (more details), 1.5 Å

PDB Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum

SCOP Domain Sequences for d1pvma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvma1 d.37.1.1 (A:1-64) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum}
mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi
prnk

SCOP Domain Coordinates for d1pvma1:

Click to download the PDB-style file with coordinates for d1pvma1.
(The format of our PDB-style files is described here.)

Timeline for d1pvma1: