Lineage for d1pvhd_ (1pvh D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536620Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 536621Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 536622Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 536673Protein Leukemia inhibitory factor (LIF) [47274] (2 species)
  7. 536674Species Human (Homo sapiens) [TaxId:9606] [63529] (2 PDB entries)
  8. 536676Domain d1pvhd_: 1pvh D: [95170]
    Other proteins in same PDB: d1pvha1, d1pvha2, d1pvhc1, d1pvhc2
    complexed with iod

Details for d1pvhd_

PDB Entry: 1pvh (more details), 2.5 Å

PDB Description: Crystal structure of leukemia inhibitory factor in complex with gp130

SCOP Domain Sequences for d1pvhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvhd_ a.26.1.1 (D:) Leukemia inhibitory factor (LIF) {Human (Homo sapiens)}
cairhpchnnlmnqirsqlaqlngsanalfilyytaqgepfpnnldklcgpnvtdfppfh
angtekaklvelyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlc
rlcskyhvghvdvtygpdtsgkdvfqkkklgcqllgkykqiiavlaqaf

SCOP Domain Coordinates for d1pvhd_:

Click to download the PDB-style file with coordinates for d1pvhd_.
(The format of our PDB-style files is described here.)

Timeline for d1pvhd_: