SCOP 1.73: Domain d1pvhc2: 1pvh C:197-301

Lineage for d1pvhc2 (1pvh C:197-301)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)

8. Domain d1pvhc2: 1pvh C:197-301 [95169]
   Other proteins in same PDB: d1pvhb_, d1pvhd_
   complexed with iod

Details for d1pvhc2

PDB Entry: 1pvh, 2.5 Å

PDB Description: Crystal structure of leukemia inhibitory factor in complex with gp130

PDB Compounds: (C:) interleukin-6 receptor beta chain

SCOP Domain Sequences for d1pvhc2:

Sequence; same for both SEQRES and ATOM records:

>d1pvhc2 b.1.2.1 (C:197-301) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
kvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedta
strssftvqdlkpfteyvfrircmkedgkgywsdwseeasgitye

Timeline for d1pvhc2:

• d1pvhc2 first appeared in SCOP 1.67
  
• d1pvhc2 appears in SCOP 1.71
  
• d1pvhc2 appears in SCOP 1.75
  
• d1pvhc2 appears in the current release, SCOPe 2.08