SCOP 1.73: Domain d1pvha1: 1pvh A:101-196

Lineage for d1pvha1 (1pvh A:101-196)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)

8. Domain d1pvha1: 1pvh A:101-196 [95165]
   Other proteins in same PDB: d1pvhb_, d1pvhd_

Details for d1pvha1

PDB Entry: 1pvh, 2.5 Å

PDB Description: Crystal structure of leukemia inhibitory factor in complex with gp130

PDB Compounds: (A:) interleukin-6 receptor beta chain

SCOP Domain Sequences for d1pvha1:

Sequence; same for both SEQRES and ATOM records:

>d1pvha1 b.1.2.1 (A:101-196) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
glppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsc
tvdystvyfvnievwveaenalgkvtsdhinfdpvy

Timeline for d1pvha1:

• d1pvha1 first appeared in SCOP 1.67
  
• d1pvha1 appears in SCOP 1.71
  
• d1pvha1 appears in SCOP 1.75
  
• d1pvha1 appears in the current release, SCOPe 2.08