SCOPe 2.07: Domain d1pvgb2: 1pvg B:8-245

Lineage for d1pvgb2 (1pvg B:8-245)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)

6. Protein DNA topoisomerase II [103226] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103227] (3 PDB entries)

8. Domain d1pvgb2: 1pvg B:8-245 [95164]
   Other proteins in same PDB: d1pvga1, d1pvgb1
   complexed with anp, mg

Details for d1pvgb2

PDB Entry: 1pvg, 1.8 Å

PDB Description: crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii

PDB Compounds: (B:) DNA topoisomerase II

SCOPe Domain Sequences for d1pvgb2:

Sequence; same for both SEQRES and ATOM records:

>d1pvgb2 d.122.1.2 (B:8-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
asdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifdei
lvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllts
snydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkits
ykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkir

Timeline for d1pvgb2:

• d1pvgb2 first appeared in SCOP 1.67
  
• d1pvgb2 appears in SCOPe 2.06
  
• d1pvgb2 appears in the current release, SCOPe 2.08