SCOP 1.75: Domain d1pv9b1: 1pv9 B:4-124

Lineage for d1pv9b1 (1pv9 B:4-124)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)

6. Protein Aminopeptidase P [53096] (2 species)
   synonym: Xaa-Pro dipeptidase, prolidase

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [102481] (1 PDB entry)

8. Domain d1pv9b1: 1pv9 B:4-124 [95159]
   Other proteins in same PDB: d1pv9a2, d1pv9b2
   complexed with zn

Details for d1pv9b1

PDB Entry: 1pv9, 2 Å

PDB Description: Prolidase from Pyrococcus furiosus

PDB Compounds: (B:) Xaa-Pro Dipeptidase

SCOP Domain Sequences for d1pv9b1:

Sequence; same for both SEQRES and ATOM records:

>d1pv9b1 c.55.2.1 (B:4-124) Aminopeptidase P {Archaeon Pyrococcus furiosus [TaxId: 2261]}
rleklvkfmdensidrvfiakpvnvyyfsgtsplgggyiivdgdeatlyvpeleyemake
esklpvvkfkkfdeiyeilkntetlgiegtlsysmvenfkeksnvkefkkiddvikdlri
i

Timeline for d1pv9b1:

• d1pv9b1 first appeared in SCOP 1.67
  
• d1pv9b1 appears in SCOP 1.73
  
• d1pv9b1 appears in SCOPe 2.01
  
• d1pv9b1 appears in the current release, SCOPe 2.08