Lineage for d1pv9b1 (1pv9 B:4-124)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488390Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) (S)
  5. 488391Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)
  6. 488392Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 488393Species Archaeon Pyrococcus furiosus [TaxId:2261] [102481] (1 PDB entry)
  8. 488395Domain d1pv9b1: 1pv9 B:4-124 [95159]
    Other proteins in same PDB: d1pv9a2, d1pv9b2

Details for d1pv9b1

PDB Entry: 1pv9 (more details), 2 Å

PDB Description: Prolidase from Pyrococcus furiosus

SCOP Domain Sequences for d1pv9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv9b1 c.55.2.1 (B:4-124) Aminopeptidase P {Archaeon Pyrococcus furiosus}
rleklvkfmdensidrvfiakpvnvyyfsgtsplgggyiivdgdeatlyvpeleyemake
esklpvvkfkkfdeiyeilkntetlgiegtlsysmvenfkeksnvkefkkiddvikdlri
i

SCOP Domain Coordinates for d1pv9b1:

Click to download the PDB-style file with coordinates for d1pv9b1.
(The format of our PDB-style files is described here.)

Timeline for d1pv9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pv9b2