Lineage for d1pv8a_ (1pv8 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421381Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 protein domains)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2421382Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 2421404Species Human (Homo sapiens) [TaxId:9606] [63921] (4 PDB entries)
  8. 2421405Domain d1pv8a_: 1pv8 A: [95155]
    complexed with pb1, zn; mutant

Details for d1pv8a_

PDB Entry: 1pv8 (more details), 2.2 Å

PDB Description: Crystal structure of a low activity F12L mutant of human porphobilinogen synthase
PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d1pv8a_:

Sequence, based on SEQRES records: (download)

>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]}
ylhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkrleemlrplve
eglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacdvclcpytshg
hcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaikealmahglgnr
vsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdrdvregadmlm
vkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaavleamtafrra
gadiiityytpqllqwlkee

Sequence, based on observed residues (ATOM records): (download)

>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]}
ylhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkrleemlrplve
eglrcvlifgvpeespaieaihllrktfpnllvacdvclcafraeesrqrlaevalayak
agcqvvapsddgrveaikealmahglgnrvsvmsysakfascfygpfrdaalppgargla
lravdrdvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagaf
dlkaavleamtafrragadiiityytpqllqwlkee

SCOPe Domain Coordinates for d1pv8a_:

Click to download the PDB-style file with coordinates for d1pv8a_.
(The format of our PDB-style files is described here.)

Timeline for d1pv8a_: