SCOPe 2.08: Domain d1pv7a_: 1pv7 A:

Lineage for d1pv7a_ (1pv7 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.38: MFS general substrate transporter [103472] (1 superfamily)
   12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar

4. Superfamily f.38.1: MFS general substrate transporter [103473] (5 families)

5. Family f.38.1.2: LacY-like proton/sugar symporter [103477] (2 proteins)
   automatically mapped to Pfam PF07690
   automatically mapped to Pfam PF01306

6. Protein Lactose permease [103478] (1 species)

7. Species Escherichia coli [TaxId:562] [103479] (3 PDB entries)

8. Domain d1pv7a_: 1pv7 A: [95153]

Details for d1pv7a_

PDB Entry: 1pv7, 3.6 Å

PDB Description: crystal structure of lactose permease with tdg

PDB Compounds: (A:) lactose permease

SCOPe Domain Sequences for d1pv7a_:

Sequence; same for both SEQRES and ATOM records:

>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]}
myylkntnfwmfglffffyffimgayfpffpiwlhdinhisksdtgiifaaislfsllfq
plfgllsdklglrkyllwiitgmlvmfapffififgpllqynilvgsivggiylgfcfna
gapaveafiekvsrrsnfefgrarmfgcvgwalgasivgimftinnqfvfwlgsgcalil
avllffaktdapssatvanavganhsafslklalelfrqpklwflslyvigvsctydvfd
qqfanfftsffatgeqgtrvfgyvttmgellnasimffapliinriggknalllagtims
vriigssfatsalevvilktlhmfevpfllvgcfkyitsqfevrfsatiylvcfcffkql
amifmsvlagnmyesigfqgaylvlglvalgftlisvftlsgpgplsllrrqvneva

Timeline for d1pv7a_:

• d1pv7a_ first appeared in SCOP 1.67
  
• d1pv7a_ appears in SCOPe 2.07