Lineage for d1pv0a_ (1pv0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980579Superfamily a.2.12: Sporulation inhibitor Sda [100985] (1 family) (S)
    automatically mapped to Pfam PF08970
  5. 1980580Family a.2.12.1: Sporulation inhibitor Sda [100986] (2 proteins)
  6. 1980581Protein Sporulation inhibitor Sda [100987] (1 species)
  7. 1980582Species Bacillus subtilis [TaxId:1423] [100988] (1 PDB entry)
  8. 1980583Domain d1pv0a_: 1pv0 A: [95141]

Details for d1pv0a_

PDB Entry: 1pv0 (more details)

PDB Description: structure of the sda antikinase
PDB Compounds: (A:) Sda

SCOPe Domain Sequences for d1pv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv0a_ a.2.12.1 (A:) Sporulation inhibitor Sda {Bacillus subtilis [TaxId: 1423]}
mrklsdelliesyfkatemnlnrdfielieneikrrslghiisvss

SCOPe Domain Coordinates for d1pv0a_:

Click to download the PDB-style file with coordinates for d1pv0a_.
(The format of our PDB-style files is described here.)

Timeline for d1pv0a_: