Class a: All alpha proteins [46456] (286 folds) |
Fold a.101: Uteroglobin-like [48200] (1 superfamily) multihelical |
Superfamily a.101.1: Uteroglobin-like [48201] (1 family) disulfide-linked dimer of two identical chains, 4 helices in each |
Family a.101.1.1: Uteroglobin-like [48202] (4 proteins) |
Protein Allergen Fel d I-A chain [101359] (1 species) forms heterodimer with Fel d I-B chain |
Species Cat (Felis catus) [TaxId:9685] [101360] (3 PDB entries) |
Domain d1puob1: 1puo B:93-164 [95136] Other proteins in same PDB: d1puoa2, d1puob2 fused with Fel d I-B complexed with mpd |
PDB Entry: 1puo (more details), 1.85 Å
SCOPe Domain Sequences for d1puob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1puob1 a.101.1.1 (B:93-164) Allergen Fel d I-A chain {Cat (Felis catus) [TaxId: 9685]} eicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenalsl ldkiytsplcle
Timeline for d1puob1: