SCOP 1.73: Domain d1puob1: 1puo B:93-164

Lineage for d1puob1 (1puo B:93-164)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.101: Uteroglobin-like [48200] (1 superfamily)
   multihelical

4. Superfamily a.101.1: Uteroglobin-like [48201] (1 family)
   disulfide-linked dimer of two identical chains, 4 helices in each

5. Family a.101.1.1: Uteroglobin-like [48202] (4 proteins)

6. Protein Allergen Fel d I-A chain [101359] (1 species)
   forms heterodimer with Fel d I-B chain

7. Species Cat (Felis catus) [TaxId:9685] [101360] (3 PDB entries)

8. Domain d1puob1: 1puo B:93-164 [95136]
   Other proteins in same PDB: d1puoa2, d1puob2
   fused with Fel d I-B
   complexed with mpd

Details for d1puob1

PDB Entry: 1puo, 1.85 Å

PDB Description: crystal structure of fel d 1- the major cat allergen

PDB Compounds: (B:) Major allergen I polypeptide, fused chain 2, chain 1

SCOP Domain Sequences for d1puob1:

Sequence; same for both SEQRES and ATOM records:

>d1puob1 a.101.1.1 (B:93-164) Allergen Fel d I-A chain {Cat (Felis catus) [TaxId: 9685]}
eicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenalsl
ldkiytsplcle

Timeline for d1puob1:

• d1puob1 first appeared in SCOP 1.67
  
• d1puob1 appears in SCOP 1.71
  
• d1puob1 appears in SCOP 1.75
  
• d1puob1 appears in the current release, SCOPe 2.08