SCOP 1.75: Domain d1puoa2: 1puo A:5-73

Lineage for d1puoa2 (1puo A:5-73)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.101: Uteroglobin-like [48200] (1 superfamily)
   multihelical

4. Superfamily a.101.1: Uteroglobin-like [48201] (1 family)
   disulfide-linked dimer of two identical chains, 4 helices in each

5. Family a.101.1.1: Uteroglobin-like [48202] (4 proteins)

6. Protein Allergen Fel d I-B chain [101361] (1 species)
   forms heterodimer with Fel d I-A chain

7. Species Cat (Felis catus) [TaxId:9685] [101362] (3 PDB entries)

8. Domain d1puoa2: 1puo A:5-73 [95135]
   Other proteins in same PDB: d1puoa1, d1puob1
   fused with Fel d I-A

Details for d1puoa2

PDB Entry: 1puo, 1.85 Å

PDB Description: crystal structure of fel d 1- the major cat allergen

PDB Compounds: (A:) Major allergen I polypeptide, fused chain 2, chain 1

SCOP Domain Sequences for d1puoa2:

Sequence; same for both SEQRES and ATOM records:

>d1puoa2 a.101.1.1 (A:5-73) Allergen Fel d I-B chain {Cat (Felis catus) [TaxId: 9685]}
etcpifydvffavangnellldlsltkvnatepertamkkiqdcyvenglisrvldglvm
ttissskdc

Timeline for d1puoa2:

• d1puoa2 first appeared in SCOP 1.67
  
• d1puoa2 appears in SCOP 1.73
  
• d1puoa2 appears in SCOPe 2.01
  
• d1puoa2 appears in the current release, SCOPe 2.08