Lineage for d1puoa2 (1puo A:5-73)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358895Fold a.101: Uteroglobin-like [48200] (1 superfamily)
    multihelical
  4. 358896Superfamily a.101.1: Uteroglobin-like [48201] (1 family) (S)
    disulfide-linked dimer of two identical chains, 4 helices in each
  5. 358897Family a.101.1.1: Uteroglobin-like [48202] (4 proteins)
  6. 358902Protein Allergen Fel d I-B chain [101361] (1 species)
    forms heterodimer with Fel d I-A chain
  7. 358903Species Cat (Felis catus) [TaxId:9685] [101362] (1 PDB entry)
  8. 358904Domain d1puoa2: 1puo A:5-73 [95135]
    Other proteins in same PDB: d1puoa1, d1puob1

Details for d1puoa2

PDB Entry: 1puo (more details), 1.85 Å

PDB Description: crystal structure of fel d 1- the major cat allergen

SCOP Domain Sequences for d1puoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puoa2 a.101.1.1 (A:5-73) Allergen Fel d I-B chain {Cat (Felis catus)}
etcpifydvffavangnellldlsltkvnatepertamkkiqdcyvenglisrvldglvm
ttissskdc

SCOP Domain Coordinates for d1puoa2:

Click to download the PDB-style file with coordinates for d1puoa2.
(The format of our PDB-style files is described here.)

Timeline for d1puoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1puoa1