![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (7 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (16 proteins) |
![]() | Protein Nucleoside triphosphate pyrophosphorylase (MutT) [55813] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55814] (6 PDB entries) |
![]() | Domain d1puna_: 1pun A: [95133] complexed with 8og, mo2 |
PDB Entry: 1pun (more details)
SCOP Domain Sequences for d1puna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane pviaklkrl
Timeline for d1puna_: