Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Homeobox protein hox-a9 [100994] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [100995] (1 PDB entry) |
Domain d1pufa_: 1puf A: [95131] Other proteins in same PDB: d1pufb_ protein/DNA complex |
PDB Entry: 1puf (more details), 1.9 Å
SCOPe Domain Sequences for d1pufa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} nnpaanwlharstrkkrcpytkhqtlelekeflfnmyltrdrryevarllnlterqvkiw fqnrrmkmkkinkdrak
Timeline for d1pufa_: