![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species) |
![]() | Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries) Uniprot Q27198 49-209 |
![]() | Domain d1puaa_: 1pua A: [95130] complex with coenzyme A and a phosphorylated histone H3 peptide, chain B complexed with coa |
PDB Entry: 1pua (more details), 2.3 Å
SCOPe Domain Sequences for d1puaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1puaa_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr
Timeline for d1puaa_: