Lineage for d1pu7a_ (1pu7 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446243Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 446244Superfamily a.96.1: DNA-glycosylase [48150] (5 families) (S)
  5. 446307Family a.96.1.5: 3-Methyladenine DNA glycosylase III (MagIII) [101349] (1 protein)
  6. 446308Protein 3-Methyladenine DNA glycosylase III (MagIII) [101350] (1 species)
  7. 446309Species Helicobacter pylori [TaxId:210] [101351] (3 PDB entries)
  8. 446312Domain d1pu7a_: 1pu7 A: [95125]

Details for d1pu7a_

PDB Entry: 1pu7 (more details), 1.93 Å

PDB Description: Crystal structure of H.pylori 3-methyladenine DNA glycosylase (MagIII) bound to 3,9-dimethyladenine

SCOP Domain Sequences for d1pu7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pu7a_ a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori}
ldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafil
enddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtre
wlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqen
lnsalalyentislaqlyarfhgkivefskqklel

SCOP Domain Coordinates for d1pu7a_:

Click to download the PDB-style file with coordinates for d1pu7a_.
(The format of our PDB-style files is described here.)

Timeline for d1pu7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pu7b_